PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr11P07620_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 263aa    MW: 29305.2 Da    PI: 6.3149
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr11P07620_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.75.4e-10861231954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  GSMUA_Achr11P07620_001  86 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 123
                             554459******************************98 PP

2BELL67.91.9e-221433072
                    BELL 30 lqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72
                            +q+v+ssFe vagl+sa+pYtslAlkaiS+hFr+Lk+ai++qi
  GSMUA_Achr11P07620_001  1 MQMVVSSFESVAGLNSATPYTSLALKAISKHFRSLKNAISDQI 43
                            9*****************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF075262.1E-16140IPR006563POX domain
PROSITE profilePS5007111.93664127IPR001356Homeobox domain
CDDcd000861.45E-1367128No hitNo description
SMARTSM003893.0E-967131IPR001356Homeobox domain
SuperFamilySSF466891.24E-1769135IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.4E-2970131IPR009057Homeodomain-like
PfamPF059208.6E-1984123IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MQMVVSSFES VAGLNSATPY TSLALKAISK HFRSLKNAIS DQIRHVSKVL GEELITLSFV  60
DHNQPVWRPQ RGLPERAVSV LRAWLFEHFL HPYPTDTDKH MLATQTGLSR NQVSNWFINA  120
RVRLWKPMIE EIHMLETKGM SGMDLNSATN GKETMVAVTE DGAHSSTYHD PPDCAPMDAV  180
LLNEEGSQQQ AWQGGDKRSR VEECEMLTGM DGGLMSFATY QHAMDMGGIE AVSLTLGLRH  240
EGGQQTPPQM RHLGAQMFHD FVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A6e-1773131563Homeobox protein Meis2
3k2a_B6e-1773131563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009382787.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLM0RQ920.0M0RQ92_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr11P07620_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16049811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.18e-66BEL1-like homeodomain 8